Recombinant Proteins

Search Within Results

2,836 – 2,850 of 122,825 results

2,836

Novus Biologicals™ Recombinant Human BOLA3 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	bolA homolog 3 (E. coli), bolA-like 3, bolA-like protein 3
Common Name	BOLA3
Molecular Weight (g/mol)	TMW: 14.5kDa
Gene ID (Entrez)	388962
Formulation	Phosphate buffered saline (pH7.4) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,837

R&D Systems™ Recombinant Human SCUBE3 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,838

Novus Biologicals™ Recombinant Human Serine racemase His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,839

Novus Biologicals™ DIMT1L Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,840

Invitrogen™ Monkeypox Virus I1L His-tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>90% as determined by SDS-PAGE.
Conjugate	Unconjugated
pH Range	7.4
Form	Lyophilized
Molecular Weight (g/mol)	37.71 kDa
Common Name	Monkeypox Virus I1L
Endotoxin Concentration	<1.0 EU/μg
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	Monkeypox I1L protein (Met1-Glu312) with an N-terminal His-tag
Expression System	E. coli
For Use With (Application)	Control,Neutralization
Name	Monkeypox Virus I1L His-tag
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Monkeypox I1L
Product Type	Protein
Formulation	20mM tris with 1mM DTT, 10% glycerol, 300mM NaCl, 22.5% trehalose and no preservative; pH 7.4
Protein Tag	His-tag
Recombinant	Recombinant

2,841

R&D Systems™ Recombinant Human CDCP1 Fc Chimera Protein

Measured by its binding ability in a functional ELISA.

Pricing & Availability

2,842

Novus Biologicals™ Recombinant Human DUSP21 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,843

Promotions Available

R&D Systems™ Recombinant Mouse SIRP beta 1a Fc Chimera Protein

Measured by its binding ability in a functional ELISA.

Pricing & Availability

2,844

Novus Biologicals Activin C/Inhibin beta C Recombinant Protein Antigen

Pricing & Availability

2,845

Gibco™ Human TGF-beta 3 Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Protein Family	Growth Factors & Receptors
Purity or Quality Grade	>98% by SDS-PAGE and HPLC
Conjugate	Unconjugated
Form	Liquid
Common Name	TGF beta-3
Molecular Weight (g/mol)	25.4 kDa
Activity	ED50 ≤ 0.05 ng/mL (≥ 12.5x10e6 IU/mg); determined by a toxicity assay using the WHO Standard 98/608 for direct comparison.
Endotoxin Concentration	<0.1 ng/μg
Expression System	E. coli
For Use With (Application)	Bioactivity
Name	Human TGF-beta 3
Purification Method	Purified
Gene Alias	ARVD; ARVD1; FLJ16571; H-TGF-b-3; LAP; Latency-associated peptide; LDS5; prepro-transforming growth factor beta-3; RNHF; TGF beta 3; Tgfb3; TGF-B3; Tgfb-3; TGF-beta3; TGF-beta-3; Transforming growth factor; transforming growth factor beta 3; transforming growth factor beta precursor; transforming growth factor beta-3; Transforming growth factor beta-3 proprotein; transforming growth factor, beta 3; transforming growth factor-beta3
Protein Form	Recombinant, Ligand
Formulation	0.12% acetic acid with 20% ethanol and no preservative
Research Category	Immunology, Neurobiology, Stem Cell Research, Bone Research, Cardiovascular Research, Oncology
Species	Human
Recombinant	Recombinant
Shipping Condition	Approved for shipment on Wet or Dry Ice
Gene Symbol	TGFB3
Sequence	Human TGF-beta 3 recombinant protein is a homodimer containing two 112 amino acid subunits
Storage Requirements	4°C
Protein Subtype	TGFs (Transforming Growth Factors)
Accession Number	P10600
Regulatory Status	RUO
Product Type	Protein
Gene ID (Entrez)	7043
Product Line	Gibco

2,846

Promotions Available

Invitrogen™ Human GP2 (aa 35-178) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
pH Range	7.4
Form	Liquid
Common Name	GP2
Gene Symbol	GP2
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCT
Concentration	0.8 mg/mL
Expression System	E. coli
For Use With (Application)	Neutralization,Control
Name	Human GP2 (aa 35-178) Control Fragment
Accession Number	P55259
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	2310037I18Rik; AV060639; glycoprotein 2; glycoprotein 2 (zymogen granule membrane); glycoprotein 80; GP2; gp80; Pancreatic secretory granule membrane major glycoprotein GP2; pancreatic zymogen granule membrane associated protein GP2; pancreatic zymogen granule membrane protein GP-2; secretory (zymogen) granule membrane glycoprotein GP2; ZAP75; zymogen granule membrane glycoprotein 2
Product Type	Protein
Gene ID (Entrez)	2813
Formulation	PBS, 1M urea with no preservative; pH 7.4
Protein Tag	His-ABP-tag
Recombinant	Recombinant

2,847

R&D Systems™ Recombinant SARS-CoV-2 B.1.617.2 S1 His-tag Protein

Delta Covid Variant

Pricing & Availability

2,848

R&D Systems™ Recombinant Human Nidogen-1/Entactin Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

2,849

R&D Systems™ Recombinant Human Thrombopoietin His (HEK-293) Protein

Analyzed by SEC-MALS. His-tag (HEK-293-expressed)

Pricing & Availability
Specifications

Accession Number	P40225.1
Purity or Quality Grade	>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining.
Conjugate	Unconjugated
Gene Alias	Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, megakaryocyte stimulating factor, MGDF, MGDFC-mpl ligand, MKCSF, MK-CSF, ML, MPL ligand, MPLLG, MPLLGMGC163194, Myeloproliferative leukemia virus oncogene ligand, THCYT1, THPO, thrombopoietin, thrombopoietin nirs variant 1, Tpo, TPOMKCSF
Molecular Weight (g/mol)	MolecularWeight-observed: 26-30 kDa, under reducing conditions., MolecularWeight-theroretical: 19 kDa
Gene ID (Entrez)	7066
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution	Reconstitute the 10 μg size at 100 μg/mL in PBS. Reconstitute all other sizes (at 500 μg/mL in PBS.)
Endotoxin Concentration	<0.10 EU / 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Protein	Thrombopoietin/THPO
Source	Human embryonic kidney cell, HEK293-derived human Thrombopoietin/Tpo protein Ser22-Leu195, with a C-terminal 6-His tag

2,850

Novus Biologicals™ KAT2A/GCN5 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

Prev
1
...
188
189
190
191
...
8,189
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human BOLA3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Serine racemase His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DIMT1L Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human DUSP21 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals Activin C/Inhibin beta C Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ KAT2A/GCN5 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human BOLA3 His Protein

Novus Biologicals™ Recombinant Human Serine racemase His Protein

Novus Biologicals™ DIMT1L Protein

Novus Biologicals™ Recombinant Human DUSP21 His Protein

Novus Biologicals Activin C/Inhibin beta C Recombinant Protein Antigen

Novus Biologicals™ KAT2A/GCN5 Protein